PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01504.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 285aa    MW: 32917.7 Da    PI: 8.8058
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01504.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.57.8e-4781343128
                      NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                              pGfrFhPt+eel ++yLk+ v gk  ++ evi  ++iy+++PwdLp+  k +e+ewyfF++r++k+ +g r++r+t++gyWkatg+
  Rsa1.0_01504.1_g00004.1   8 PGFRFHPTEEELTDYYLKNMVYGKFSKV-EVIGFLNIYRHDPWDLPRLSKIGEREWYFFVPRERKHGNGGRPSRTTEKGYWKATGS 92 
                              9***********************9999.99***************8778899********************************* PP

                      NAM  89 dkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              d++++s    ++++glkktLvfy+grap g+ktdWvm+eyr+
  Rsa1.0_01504.1_g00004.1  93 DRKIISLsePKRVIGLKKTLVFYRGRAPGGSKTDWVMNEYRM 134
                              ****987557778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.4996152IPR003441NAC domain
SuperFamilySSF1019417.72E-557152IPR003441NAC domain
PfamPF023653.4E-258134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSKEIELPGF RFHPTEEELT DYYLKNMVYG KFSKVEVIGF LNIYRHDPWD LPRLSKIGER  60
EWYFFVPRER KHGNGGRPSR TTEKGYWKAT GSDRKIISLS EPKRVIGLKK TLVFYRGRAP  120
GGSKTDWVMN EYRMPDNCTL PKDVVLCKIY RKATSLKVLE QRAEMESKMN QTCPNSPLSS  180
SETVSYVGKE EDLMMNSFPF PQASAMQEAN NNFMLQGHTD NAKNEEKQRE TEMKESSSSL  240
KLPCGVLPLT ELQLPKQGLE WGQDQFLSIS PWLQNLTPII NLLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-44815217168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533070.0AK353307.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-40-I17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609230.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLA0A078GNG80.0A0A078GNG8_BRANA; BnaC09g09210D protein
TrEMBLA0A0D3E3380.0A0A0D3E338_BRAOL; Uncharacterized protein
STRINGBra037283.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-174NAC domain containing protein 36